RecombinantFlt-3L, Human

CAT:
384-BK0203-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantFlt-3L, Human - image 1

RecombinantFlt-3L, Human

  • Description:

    Fms-related tyrosine kinase 3 ligand (Flt3L) is growth fator stimulates the proliferation and differentiation of hematopoietic multipotent progenitors and promotes proliferation of NK cells and dendritic cell subgroups by combination with other growth factors. Flt3L is produced by T cells and stromal fibroblasts, and targeted various cells including hematopoietic stem cells, B cells, T cells, dendritic cells, and NK cells [1][2]. Flt3L binds to it cognate tyrosine kinase receptor Flt3 and activates JAK/STAT signaling pathway[3].Flt3L is a hematopoietic four helical bundle cytokine with structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1) demonstrated four conserved cysteines and two glycosylation sites. Flt3L naturally as a non-disulfide-linked homodimer with multiple isoforms. The extracellular portion is approximately 160 amino acid residues in length and the cytoplasmic segment is approximately 20-30 amino acid residues in length[4].
  • Endotoxin:

    <0.2 EU/μg, determined by LAL method.
  • Purity:

    > 95% as analyzed by SDS-PAGE and HPLC.
  • Bioactivity:

    ED50< 1 ng/ml, measured in a cell proliferation assay of human AML5 cells, corresponding to a specific activity of > 1 x 10ˆ6 units/mg
  • Reconstitution:

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight:

    Multiple bands between 18~22 kDa, observed by reducing SDS-PAGE.
  • Storage Conditions:

    Lyophilized recombinant human Fms-related tyrosine kinase 3 ligand (Flt-3 Ligand) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFlt-3L should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance:

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation:

    Lyophilized after extensive dialysis against PBS.
  • Host or Source:

    CHO
  • Recommended Usage:

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • CAS Number:

    9000-83-3
  • AA Sequence:

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA