Products for Research Use Only
RegisterLogin

MEC/CCL28, Rat

CAT: 0804-HY-P7252-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7252-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MEC/CCL28 Protein, Rat is a CC chemokine that is present in almost all mucosal tissues and acts as a unifying immunostimulant on mucosal surfaces. CCL28 can bind to CCR3 and CCR10 to mediate immune responses, viral infections, cancer, and antimicrobial effects. MEC/CCL28 Protein, Rat is a recombinant rat MEC/CCL28 (S20-R135) protein expressed by E. coli[1][2].
Product Name Alternative
MEC/CCL28 Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mec-ccl28-protein-rat.html
Purity
95.00
Smiles
SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR
Molecular Formula
114492 (Gene_ID) Q91Y39 (S20-R135) (Accession)
Molecular Weight
Approximately 17.8 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Meurens F, et al. Expression of mucosal chemokines TECK/CCL25 and MEC/CCL28 during fetal development of the ovine mucosal immune system. Immunology. 2007 Apr;120 (4) :544-55.|[2]Hiroyuki Ogawa, et al. Regulated production of the chemokine CCL28 in human colon epithelium. Am J Physiol Gastrointest Liver Physiol. 2004 Nov;287 (5) :G1062-9.|[3]Teena Mohan, et al. CCL28 chemokine: An anchoring point bridging innate and adaptive immunity. Int Immunopharmacol. 2017 Oct;51:165-170.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7251-01MEC/CCL28, Mouse
HY-P7250-01MEC/CCL28, Human
HY-P75447MEC/CCL28, Human (His)
HY-P11454-01PSM-mec peptide
HY-RS23703Ccl28 Rat Pre-designed siRNA Set A
HY-174754Human CCL28 mRNA
HY-RS17249Ccl28 Mouse Pre-designed siRNA Set A
HY-RS02098CCL28 Human Pre-designed siRNA Set A
HY-P7249-01MDC/CCL22, Rat
HY-P700009-01CCL24/Eotaxin-2, Rat

Alternative Products

CatalogName
M10-090-L500MEC (CCL28)
RC315-39MEC, CCL28, human
MBS197062-01Recombinant CCL28 (MEC)
MBS444015-01Human CCL28 (MEC)
QY-E21773Mouse CCL28 / MEC
MBS691608-01Human MEC (CCL28)
RC355-39MEC, CCL28, rat
MBS691563-01Mouse MEC (CCL28)
JOT-PR2007Recombinant Mouse MEC/CCL28 (rMuMEC/CCL28)
GTR18991563-01Recombinant Mouse MEC/CCL28 (rMuMEC/CCL28)

Popular Products