EGF, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


EGF, Mouse
Description :
EGF Protein, Mouse is a growth factor that stimulates the proliferation of the epidermis and several epithelial tissues.Product Name Alternative :
EGF Protein, Mouse, Mouse, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsRelated Pathways :
OthersAssay Protocol :
https://www.medchemexpress.com/cytokines/egf-protein-mouse.htmlPurity :
98.0Smiles :
NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRMolecular Formula :
13645 (Gene_ID) P01132 (N977-R1029) (Accession)Molecular Weight :
Approximately 6-7 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Hynes NE, et al. ERBB receptors and cancer: the complexity of targeted inhibitors. Nat Rev Cancer. 2005 May;5 (5) :341-54.|[2]Salomon DS, et al. Epidermal growth factor-related peptides and their receptors in human malignancies. Crit Rev Oncol Hematol. 1995 Jul;19 (3) :183-232.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

