GMP EGF, Human

CAT: 0804-HY-P7109GSize: 50 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7109GSize:50 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. GMP EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

Product Name Alternative

GMP EGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-egf-protein-human.html

Purity

98.0

Smiles

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Formula

1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)

Molecular Weight

Approximately 9.6-11 kDa

References & Citations

[1]Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71.|[2]Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102 (2) :89-98. |[3]Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102 (2) :89-98.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P70593G	GMP Fibronectin, Human
HY-P7110G	GMP VEGF165, Human
HY-P7116G-01	GMP BDNF, Human
HY-P7109-01	EGF, Human
HY-P70591G	GMP IL-18, Human
HY-P70776G	GMP IL-15, Human
HY-P7044G	GMP IL-6, Human
HY-P78550	GMP IL-7, Human
HY-P7055G	GMP PDGF-BB, Human
HY-P78549-01	GMP IL-4, Human

Alternative Products

Catalog	Name
Z02691-100	EGF, Human
300-110P-5mg	Human EGF
CYT-217-01	EGF Human
PGR-4498-S	EGF (Human)
4030572.05	rec EGF (human)
MBS9719444-01	Human EGF protein
MBS7610736-01	Recombinant Human EGF
MBS8202071-01	EGF siRNA (Human)

GMP EGF, Human

Related Products

Alternative Products

Popular Products