EGF, Rat

• Description:

  EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

• Product Name Alternative:

  EGF Protein, Rat, Rat, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/egf-protein-rat.html

• Purity:

  97.00

• Smiles:

  NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

• Molecular Formula:

  25313 (Gene_ID) P07522/NP_036974.1 (N974-R1026) (Accession)

• Molecular Weight:

  Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197 (1) :32-8.|[2]Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins