EGF, Human

• Description :

  EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  EGF Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Related Pathways :

  JAK/STAT Signaling;Protein Tyrosine Kinase/RTK

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/egf-protein-human.html

• Purity :

  98.00

• Smiles :

  NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

• Molecular Formula :

  1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)

• Molecular Weight :

  Approximately 5-11 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71.|[2]Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102 (2) :89-98.|[3]Pouranvari S, et al., Cloning, Expression, and Cost Effective Purification of Authentic Human Epidermal Growth Factor With High Activity. Iran Red Crescent Med J. 2016 Mar 20;18 (3) :e24966.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins