EGF, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


EGF, Human
Description :
EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human is the recombinant human-derived EGF protein, expressed by E. coli , with tag free.Product Name Alternative :
EGF Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsRelated Pathways :
JAK/STAT Signaling;Protein Tyrosine Kinase/RTKAssay Protocol :
https://www.medchemexpress.com/cytokines/egf-protein-human.htmlPurity :
98.00Smiles :
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRMolecular Formula :
1950 (Gene_ID) P01133-1 (N971-R1023) (Accession)Molecular Weight :
Approximately 5-11 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71.|[2]Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102 (2) :89-98.|[3]Pouranvari S, et al., Cloning, Expression, and Cost Effective Purification of Authentic Human Epidermal Growth Factor With High Activity. Iran Red Crescent Med J. 2016 Mar 20;18 (3) :e24966.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

