PTH, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PTH, Human
Description :
PTH Protein, Human is a major regulator of mineral ion metabolism.Product Name Alternative :
PTH Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/pth-protein-human.htmlPurity :
98Smiles :
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQMolecular Formula :
5741 (Gene_ID) P01270 (S32-Q115) (Accession)Molecular Weight :
Approximately 9-15 kDaReferences & Citations :
[1]Kim ES, et al. Recombinant Human Parathyroid Hormone (1-84) : A Review in Hypoparathyroidism. Drugs. 2015 Jul;75 (11) :1293-303.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

