ARC, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


ARC, Human
Description :
ARC Protein, Human that exists in monomeric, oligomeric forms and is capable of reversible self-oligomerization. ARC Protein is a master regulator of long-term synaptic plasticity and memory[1].Product Name Alternative :
ARC Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/arc-protein-human.htmlPurity :
95.0Smiles :
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDSMolecular Formula :
8996 (Gene_ID) O60936 (M1-S208) (Accession)Molecular Weight :
Approximately 29.0 kDaReferences & Citations :
[1]Craig Myrum, et al. Arc Is a Flexible Modular Protein Capable of Reversible Self-Oligomerization. Biochem J. 2015 May 15;468 (1) :145-58.Shipping Conditions :
Dry iceStorage Conditions :
Stored at -80°C for 1 yearScientific Category :
Recombinant Proteins

