FGF-8a, Human

• Description :

  GF-8a Protein, Human is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.

• Product Name Alternative :

  FGF-8a Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-8a-protein-human.html

• Purity :

  97

• Smiles :

  MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

• Molecular Formula :

  2253 (Gene_ID) P55075-2 (Q23-R204) (Accession)

• Molecular Weight :

  Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins