GMP FGF basic/bFGF, Human

CAT:
804-HY-P70440G
Size:
50 μg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GMP FGF basic/bFGF, Human - image 1

GMP FGF basic/bFGF, Human

  • Description:

    FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].GMP FGF basic/bFGF Protein, Human, consists of 157 amino acids, produced by E.coli with tag free.
  • Product Name Alternative:

    GMP FGF basic/bFGF Protein, Human, Human, E. coli
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/gmp-fgf-basic-bfgf-protein-human.html
  • Purity:

    98.0
  • Smiles:

    GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
  • Molecular Formula:

    2247 (Gene_ID) P09038-4 (G132-S288) (Accession)
  • Molecular Weight:

    Approximately 16 kDa
  • References & Citations:

    [1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.
  • Shipping Conditions:

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions:

    Stored at -20°C for 2 years
  • Scientific Category:

    Recombinant Proteins