FGF basic/bFGF, Human (145a.a)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FGF basic/bFGF, Human (145a.a)
Description:
FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (145a.a), consists of 145 amino acids, produced by E.coli with tag free.Product Name Alternative:
FGF basic/bFGF Protein, Human (145a.a), Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-human-145a-a.htmlPurity:
98.0Smiles:
ALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKSMolecular Formula:
2247 (Gene_ID) P09038-4 (A144-S288) (Accession)Molecular Weight:
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.References & Citations:
[1]Westermann R, et al. Basic fibroblast growth factor (bFGF), a multifunctional growth factor for neuroectodermal cells. J Cell Sci Suppl. 1990;13:97-117.|[2]Rusnati M, et al. Interaction of angiogenic basic fibroblast growth factor with endothelial cell heparan sulfate proteoglycans. Biological implications in neovascularization. Int J Clin Lab Res. 1996;26 (1) :15-23.|[3]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[4]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[5]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
