FGF basic/bFGF, Human (K128N, solution)

CAT: 0804-HY-P70600-01Size: 2 µgDry Ice: YesHazardous: No
CAT#:0804-HY-P70600-01Size:2 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (K128N, solution), consists of 155 amino acids, produced by E.coli with tag free.
Product Name Alternative
FGF basic/bFGF Protein, Human (K128N, solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-2-protein-human-k128n.html
Purity
99.90
Smiles
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALNRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular Formula
2247 (Gene_ID) P09038-2/BAG70135.1 (M1-S155, K128N) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[2]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.|[3]Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11 (1-2) :41-9.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P70600A-01FGF basic/bFGF, Human (K128N)
HY-P7179-01FGF basic/bFGF, Bovine
HY-P7004-01FGF basic/bFGF, Human (146a.a)
HY-P7331-01FGF basic/bFGF, Human (154a.a)
HY-P70440-01FGF basic/bFGF, Human (157a.a)
HY-P7330-01FGF basic/bFGF, Human (145a.a)
HY-P70440GGMP FGF basic/bFGF, Human
HY-P7331A-01FGF basic/bFGF, Human (154a.a, His)
HY-P700476-01FGF basic/bFGF, Bovine (His)
HY-P7330A-01FGF basic/bFGF, Human (145a.a, His)

Alternative Products

CatalogName
19155-81BFGF (basic FGF) Solution, Human, Recombinant (154 a.a.), Animal-Free
19155-07bFGF (basic FGF) Solution, Human, Recombinant (154 a.a.) , Animal-Free
CH88-10ugRecombinant Human Fibroblast Growth Factor 2/FGF-2/bFGF (K128N)
CH88-01Recombinant Human FGFb (K128N)
EH0024Human FGF basic/FGF2/bFGF ELISA Kit
ABC-GF0045Recombinant Human FGF basic/FGF2/bFGF Protein
OM770037-01Recombinant Human Basic Fibroblast Growth Factor (bFGF)
MBS3800782-01Human Basic Fibroblast Growth Factor (bFGF) ELISA Kit
MBS162478-01Human basic fibroblast growth factor, bFGF ELISA Kit
MBS9419929-01Recombinant Human Fibroblast Growth Factor-basic (rHu bFGF)

Popular Products