FGF basic/bFGF, Bovine

• Description :

  FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF protein, Bovine, consists of 146 amino acids, produced by E.coli with tag free.

• Product Name Alternative :

  FGF basic/bFGF protein, Bovine, Bovine, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-basic-bfgf-protein-bovine.html

• Purity :

  98.0

• Smiles :

  PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

• Molecular Formula :

  281161 (Gene_ID) P03969 (P10-S155) (Accession)

• Molecular Weight :

  Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Wang X, et al. Analysis of segregation distortion and association of the bovine FGF2 with fertilization rate and early embryonic survival. Anim Genet. 2009 Oct;40 (5) :722-8.|[2]Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15 (9) :2129-2142.|[3]Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24 (4) :311-318.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins