Products for Research Use Only
RegisterLogin

IL-13, Human

CAT: 0804-HY-P72795-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72795-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-13 is a multifunctional cytokine. IL-13 activates the JAK-STAT6 signaling pathway and regulates gene expression by binding to the type II IL-4 receptor complex (IL-4Rα/IL-13Rα1) on the cell surface. IL-13 can induce monocyte CD23 expression, B cell IgE synthesis, fibroblast eotaxin secretion, and enhanced calcium flux in airway smooth muscle cells. IL-13 promotes airway inflammation in mice. IL-13 Protein, Human is a recombinant IL-13 protein expressed by E. coli without a tag.
Product Name Alternative
IL-13 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-13-protein-human.html
Purity
97.00
Smiles
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Molecular Formula
3596 (Gene_ID) P35225 (G35-N146) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Junttila IS, et al. Tuning sensitivity to IL-4 and IL-13: differential expression of IL-4Ralpha, IL-13Ralpha1, and gammac regulates relative cytokine sensitivity. J Exp Med. 2008 Oct 27;205 (11) :2595-608. |[2]Shimamura T, et al. Novel role of IL-13 in fibrosis induced by nonalcoholic steatohepatitis and its amelioration by IL-13R-directed cytotoxin in a rat model. J Immunol. 2008 Oct 1;181 (7) :4656-65.|[3]Blanchard C, et al. Inhibition of human interleukin-13-induced respiratory and oesophageal inflammation by anti-human-interleukin-13 antibody (CAT-354) . Clin Exp Allergy. 2005 Aug;35 (8) :1096-103. |[4]de Waal Malefyt R, et al. Effects of IL-13 on phenotype, cytokine production, and cytotoxic function of human monocytes. Comparison with IL-4 and modulation by IFN-gamma or IL-10. J Immunol. 1993 Dec 1;151 (11) :6370-81. |[5]May RD, et al. Preclinical development of CAT-354, an IL-13 neutralizing antibody, for the treatment of severe uncontrolled asthma. Br J Pharmacol. 2012 May;166 (1) :177-93.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P70460-01IL-13, Mouse
HY-P7099-01IL-13, Rat
HY-P73168-01IL-13, Mouse (HEK293)
HY-P73165-01IL-13, Cynomolgus (HEK293)
HY-P990444Anti-IL-13 Antibody (M1295)
HY-P72595-01IL-13, Mouse (HEK293, His)
HY-P73166IL-13, Cynomolgus (HEK293, His)
HY-P990443Anti-IL-13 Antibody (H2L6)
HY-P78760-01IL-13, Canine (HEK293, His)
HY-P78557-01IL-13, Cotton Rat (His)

Alternative Products

CatalogName
Z05433-500IL-13, Human
600134Human IL-13
OM296742-01IL 13 Human
RC212-24IL-13, Interleukin-13, human
IT-300-132p-01Human Interleukin-13/IL13/IL-13
MBS650797-01Interleukin 13, Recombinant, Human (IL-13)
GWB-1C2E78Interleukin-13 (IL-13) Human Recombinant
PT_41143-01Interleukin-13 Human Recombinant (IL 13 Human)
BL10731_R-01Recombinant Human IL-13
4164-10IL-13, human recombinant

Popular Products