IL-13, Mouse

• Description :

  IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].

• Product Name Alternative :

  IL-13 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-13-protein-mouse.html

• Purity :

  98.0

• Smiles :

  SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

• Molecular Formula :

  16163 (Gene_ID) P20109 (S26-F131) (Accession)

• Molecular Weight :

  Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158 (6) :2898-903.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins