IL-13, Rat

• Description :

  IL-13 Protein, Rat is a cytokine secreted by many cell types, but especially T helper type 2 (Th2) cells, that is an important mediator of allergic inflammation and disease.

• Product Name Alternative :

  IL-13 Protein, Rat, Rat, E. coli

• UNSPSC :

  12352202

• Purity :

  98.0

• Smiles :

  TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH

• Molecular Formula :

  116553 (Gene_ID) P42203 (T19-H131) (Accession)

• Molecular Weight :

  Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Ma Y, et al. Novel recombinant interleukin-13 peptide-based vaccine reduces airway allergic inflammatoryresponses in mice. Am J Respir Crit Care Med. 2007 Sep 1;176 (5) :439-45.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins