IL 13 Human

• Description:

  Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.

• Swiss Prot:

  P35225

• Source:

  Escherichia Coli.

• Buffer:

  The protein (1 mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

• Storage Conditions:

  Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS