IL 13 Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








IL 13 Human
Description :
Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.Swiss Prot :
P35225Source :
Escherichia Coli.Buffer :
The protein (1 mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.Storage Conditions :
Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.Sequence Similarities :
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS

