IL 13 Human

CAT:
1071-OM296742-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL 13 Human - image 1
IL 13 Human - image 2
Thumbnail 1
Thumbnail 2

IL 13 Human

  • Description :

    Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa.
  • Swiss Prot :

    P35225
  • Source :

    Escherichia Coli.
  • Buffer :

    The protein (1 mg/mL) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.
  • Storage Conditions :

    Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.
  • Sequence Similarities :

    GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide