RANTES/CCL5, Human (HEK293)

CAT: 0804-HY-P7282-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7282-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human (HEK293) is a recombinant human RANTES/CCL5 (S24-S91) protein expressed by HEK293[1].

Product Name Alternative

RANTES/CCL5 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-human-hek293.html

Purity

98.00

Smiles

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Molecular Formula

6352 (Gene_ID) P13501 (S24-S91) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Shih-Wei Wang, et al. CCL5 and CCR5 interaction promotes cell motility in human osteosarcoma. PLoS One. 2012;7 (4) :e35101.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P78249-01	RANTES/CCL5, Mouse (HEK293, Fc)
HY-P7283	RANTES/CCL5, Human
HY-P70450-01	RANTES/CCL5, Human
HY-P71890-01	RANTES/CCL5, Mouse
HY-P78399-01	RANTES/CCL5, Human (His-SUMO)
HY-P7761-01	RANTES/CCL5, Rat (His)
HY-P700861-01	RANTES/CCL5, Human (Biotinylated, His-Avi)
HY-P74602-01	RANTES/CCL5, Rat (P.pastoris, His)
HY-174751	Human CCL5 mRNA
HY-P4191	Met-RANTES (human)

Alternative Products

Catalog	Name
MBS8114216-01	Human CCL5/RANTES HEK293 Overexpression Lysate
TMPS-00121-01	CCL5 Protein, Human, Recombinant (HEK293)
GTR18990214-01	RecombinantRANTES/CCL5, Human (HEK293-expressed)
BK0329	RecombinantRANTES/CCL5,Human(HEK293-expressed)
GTR19063388-01	Recombinant human CCL5 Protein, N-MBP & C-His (HEK293)
Z02832-20	RANTES/CCL5, Human
RC315-16	RANTES, CCL5, human
MBS444003-01	Human CCL5 (RANTES)
045-50	CCL5 / RANTES (Human)
E55A12433	Human CCL5/RANTES

RANTES/CCL5, Human (HEK293)

Related Products

Alternative Products

Popular Products