RANTES/CCL5, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RANTES/CCL5, Human
Description:
RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli[1][2].Product Name Alternative:
RANTES/CCL5 Protein, Human, Human, E. coliUNSPSC:
12352202Type:
Recombinant ProteinsAssay Protocol:
https://www.medchemexpress.com/cytokines/ccl5-protein-human.htmlPurity:
98.0Smiles:
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMSMolecular Formula:
6352 (Gene_ID) P13501 (S24-S91) (Accession)Molecular Weight:
Approximately 9-12 kDa, based on SDS-PAGE under reducing conditions.References & Citations:
[1]Suffee N, et al. RANTES/CCL5-induced pro-angiogenic effects depend on CCR1, CCR5 and glycosaminoglycans. Angiogenesis. 2012 Dec;15 (4) :727-44. |[2]Maillard L, et al. RANTES/CCL5 mediated-biological effects depend on the syndecan-4/PKCα signaling pathway. Biol Open. 2014 Sep 26;3 (10) :995-1004. |[3]Agere SA, et al. RANTES/CCL5 Induces Collagen Degradation by Activating MMP-1 and MMP-13 Expression in Human Rheumatoid Arthritis Synovial Fibroblasts. Front Immunol. 2017 Oct 18;8:1341. |[4]Tekkanat KK, et al. RANTES (CCL5) production during primary respiratory syncytial virus infection exacerbates airway disease. Eur J Immunol. 2002 Nov;32 (11) :3276-84. |[5]Wang SW, et al. CCL5 and CCR5 interaction promotes cell motility in human osteosarcoma. PLoS One. 2012;7 (4) :e35101. |[6]Wang X, et al. Oligomeric structure of the chemokine CCL5/RANTES from NMR, MS, and SAXS data. Structure. 2011 Aug 10;19 (8) :1138-48. |[7]Ergen AV, et al. Rantes/Ccl5 influences hematopoietic stem cell subtypes and causes myeloid skewing. Blood. 2012 Mar 15;119 (11) :2500-9.Shipping Conditions:
Room temperature in continental US; may vary elsewhere.Storage Conditions:
Stored at -20°C for 2 yearsScientific Category:
Recombinant Proteins
