RANTES/CCL5, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RANTES/CCL5, Mouse
Description :
RANTES/CCL5 Protein, Mouse is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Mouse is a recombinant mouse CCL5 (S24-S91) protein expressed by E. coli[1].Product Name Alternative :
RANTES/CCL5 Protein, Mouse, Mouse, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-mouse.htmlPurity :
98.95Smiles :
SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMSMolecular Formula :
20304 (Gene_ID) P30882 (S24-S91) (Accession)Molecular Weight :
Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

