Products for Research Use Only
RegisterLogin

FGF-5, Human (GST)

CAT: 0804-HY-P700480-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P700480-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The FGF-5 protein critically regulates cell proliferation and differentiation, particularly during the hair growth cycle. It plays a key role in normal hair follicle progression, inhibiting hair elongation by promoting the anagen to catagen transition. FGF-5 Protein, Human (GST) is the recombinant human-derived FGF-5 protein, expressed by E. coli , with N-GST labeled tag.
Product Name Alternative
FGF-5 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-5-protein-human-gst.html
Smiles
AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Molecular Formula
2250 (Gene_ID) P12034-1 (A18-G268) (Accession)
Molecular Weight
54.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P700067AF-01Animal-Free FGF-5, Human (His)
HY-P704520-01FGF-BP1, Human
HY-P7346FGF-8, Human
HY-P700287-01FGF-17, Human
HY-P7014-01FGF-4, Human
HY-P7001-01FGF-1, Human
HY-P7123-01FGF-18, Human
HY-P7172-01FGF-19, Human
HY-P7013-01FGF-23, Human
HY-P72803-01FGF-13, Human

Alternative Products

CatalogName
TMPH-01335-01FGF-5 Protein, Human, Recombinant (GST & His & Myc)
PT_71948-01PGP9.5 Human Recombinant, GST Tag (PGP9.5 Human, GST Tag)
MBS480632-01GST M5-5, Recombinant Human
MBS480631-01GST A5-5, Recombinant Human
abx252593Human Glutathione S Transferase Alpha 5 (GSTΑ5) ELISA Kit
EH3192Human GSTα5 (Glutathione S Transferase Alpha 5) ELISA Kit
EK340704Human GSTα5 (Glutathione S Transferase Alpha 5) ValidElisa Kit
E-EL-H1346ELISA kit for Human GST?5 (Glutathione S Transferase Alpha 5)
E-CL-H0884CLIA kit for Human GST?5 (Glutathione S Transferase Alpha 5)
P518714TGFBR1/ALK-5 Protein (N-His-GST, Human)

Popular Products