IL-17A, Mouse (E. coli)

• Description :

  IL-17A protein is an important effector cytokine that activates the NF-kappa-B and MAPkinase pathways through the IL17RA-IL17RC receptor complex to protect host tissues from microbial threats. As a key Th17 cytokine, IL-17A mediates neutrophil activation, chemotaxis, and contributes to germinal center formation. IL-17A Protein, Mouse (E. coli) is the recombinant mouse-derived IL-17A protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  IL-17A Protein, Mouse (E. coli), Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-17a-protein-mouse-e-coli.html

• Purity :

  97

• Smiles :

  TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

• Molecular Formula :

  16171 (Gene_ID) Q62386 (T22-A158) (Accession)

• Molecular Weight :

  Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins