IL-3, Mouse

• Description:

  IL-3 Protein, Mouse functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

• Product Name Alternative:

  IL-3 Protein, Mouse, Mouse, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Related Pathways:

  Immunology/Inflammation

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/il-3-protein-mouse.html

• Purity:

  98.0

• Smiles:

  DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

• Molecular Formula:

  16187 (Gene_ID) P01586 (D33-C166) (Accession)

• Molecular Weight:

  Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins