IL-3, Human

• Description:

  IL-3 Protein, Human is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. IL-3 Protein, Human plays a role in neural cell proliferation and survival. IL-3 Protein, Human inhibits NF-κB nuclear translocation and activation, and inhibits osteoclast differentiation. IL-3 Protein, Human is the recombinant human-derived IL-2 Protein, expressed by E. coli.

• Product Name Alternative:

  IL-3 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/il-3-protein-human.html

• Purity:

  98.00

• Smiles:

  APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

• Molecular Formula:

  3562 (Gene_ID) P08700 (A20-F152) (Accession)

• Molecular Weight:

  Approximately 15.2 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.|[3]Santoli D, et al., Amplification of IL-2-driven T cell proliferation by recombinant human IL-3 and granulocyte-macrophage colony-stimulating factor. J Immunol.|[4]Mayer P, et al. The in vivo effects of recombinant human interleukin-3: demonstration of basophil differentiation factor, histamine-producing activity, and priming of GM-CSF-responsive progenitors in nonhuman primates[J]. 1989.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins