IL-3, Mouse

CAT:
804-HY-P7062A-01
Size:
2 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IL-3, Mouse - image 1

IL-3, Mouse

  • Description:

    IL-3 Protein, Mouse (His) is a pleiotropic cytokine containing 135 amino acids, which functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.
  • Product Name Alternative:

    IL-3 Protein, Mouse (His), Mouse, E. coli
  • UNSPSC:

    12352202
  • Type:

    Recombinant Proteins
  • Assay Protocol:

    https://www.medchemexpress.com/cytokines/recombinant-mouse-interleukin-3.html
  • Purity:

    98.00
  • Smiles:

    DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
  • Molecular Formula:

    16187 (Gene_ID) P01586 (D33-C166) (Accession)
  • Molecular Weight:

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations:

    [1]Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24 (7) :839-47.|[2]Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.
  • Shipping Conditions:

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions:

    Stored at -20°C for 2 years
  • Scientific Category:

    Recombinant Proteins