IL-3, Mouse (HEK293)

• Description :

  IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts. It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes. In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation. IL-3 Protein, Mouse (HEK293) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with tag free.

• Product Name Alternative :

  IL-3 Protein, Mouse (HEK293), Mouse, HEK293

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/il-3-protein-mouse-hek293.html

• Purity :

  98.0

• Smiles :

  MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

• Molecular Formula :

  16187 (Gene_ID) P01586 (A27-C166) /NP_034686.2 (Accession)

• Molecular Weight :

  Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins