Products for Research Use Only
RegisterLogin

Testin, Human (His)

CAT: 0804-HY-P71353-01Size: 10 µgDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71353-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.
Product Name Alternative
Testin Protein, Human (His), Human, E. coli
UNSPSC
12352202
Smiles
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
Molecular Formula
26136 (Gene_ID) Q9UGI8 (M1-S421) (Accession)
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P76654-01Testican 1/SPOCK1, Human (sf9, His)
HY-P70573A-01IRF5, Human (His)
HY-P705610METTL14, Human (His)
HY-P705479-01SFTPA1, Human (His)
HY-P705446RAF1, Human (His)
HY-P705436TIA1, Human (His)
HY-P705431METTL7B, Human (His)
HY-P705422-01NAT1, Human (His)
HY-P704865ITGB7, Human (His)
HY-P704253-01YAP1, Human (His)

Alternative Products

CatalogName
TMPJ-01377-01Testin Protein, Human, Recombinant (His)
P518675Testin; TES Protein (C-His, Human)
PR02224Recombinant Human Testin Protein, C-His
PKSH033102-01Recombinant Human Testin/TES Protein (His Tag)
KMH1790-01Recombinant Human Testin/TES Protein, His Tag
AR09622PU-NTestin / TES (1-421, His-tag) Human Protein
T2944Testin, aa1-421, Recombinant, Human, His-Tag, E.coli (TESS, TESS-2, TESTIN, TES)
MBS8433530-01Human Testin Recombinant Protein C-6 His Tag Lyophilized
IHUTESTINRC6HISLY50UGHuman Testin Recombinant Protein C-6 His Tag Lyophilized 50UG
MBS7611595-01Recombinant Human Testin

Popular Products