Products for Research Use Only
RegisterLogin

HSF2, Human (His)

CAT: 0804-HY-P70406Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70406Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag.
Product Name Alternative
HSF2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hsf2-protein-human-his.html
Smiles
SENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
Molecular Formula
3298 (Gene_ID) Q03933 (S411-S536) (Accession)
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS06409HSF2 Human Pre-designed siRNA Set A
HY-P82490-01Hsf2 Antibody (YA2235, Rabbit)
HY-P73918-01HSF1, Human (His)
HY-RS19141Hsf2 Mouse Pre-designed siRNA Set A
HY-RS25632Hsf2 Rat Pre-designed siRNA Set A
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)

Alternative Products

CatalogName
TMPJ-01080-01HSF2 Protein, Human, Recombinant (His)
MBS1574473-01Recombinant Human HSF2, N-His
P504746HSF2 Protein (N-His, Human)
HC530032-01Human HSF2 Recombinant Protein (N-His)
KMH1226-01Recombinant Human HSF2 Protein, His Tag
GTR19075601-01Recombinant Human HSF2 Protein, N-His
PKSH032521-01Recombinant Human HSF2 Protein (His Tag)
PV020421HSF2 Protein Vector (Human) (pPB-C-His)
PV053214HSF2 Protein Vector (Human) (pPB-N-His)
PV020424HSF2 Protein Vector (Human) (pPM-C-His)

Popular Products