HSF2, Human (His)

• Description :

  As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  HSF2 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/hsf2-protein-human-his.html

• Smiles :

  SENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS

• Molecular Formula :

  3298 (Gene_ID) Q03933 (S411-S536) (Accession)

• Molecular Weight :

  Approximately 26 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Scientific Category :

  Recombinant Proteins