Products for Research Use Only
RegisterLogin

LSM4, Human (His)

CAT: 0804-HY-P70944Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70944Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex) .In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA.LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E.coli , with N-6*His labeled tag.
Product Name Alternative
LSM4 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lsm4-protein-human-his.html
Smiles
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Molecular Formula
25804 (Gene_ID) Q9Y4Z0 (M1-Q139) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS07859LSM4 Human Pre-designed siRNA Set A
HY-RS27887Lsm4 Rat Pre-designed siRNA Set A
HY-RS21368Lsm4 Mouse Pre-designed siRNA Set A
HY-P70198LSM1, Human (His)
HY-P75915-01LSM3, Human (His)
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)
HY-P75930-01MTSS1, Human (His)

Alternative Products

CatalogName
P516745LSM4 Protein (N-His, Human)
TMPJ-01410-01LSM4 Protein, Human, Recombinant (His)
KMH1360-01Recombinant Human LSM4 Protein, His Tag
PR00421Recombinant Human LSM4 Protein, N-His
PKSH033173-01Recombinant Human LSM4 Protein (His Tag)
AR09800PU-LLSM4 (1-139, His-tag) Human Protein
PV092642LSM4 Protein Vector (Human) (pPB-C-His)
PV092643LSM4 Protein Vector (Human) (pPB-N-His)
PV092645LSM4 Protein Vector (Human) (pPM-C-His)
MBS203784-01LSM4, 1-139aa, Human, His tag, E Coli

Popular Products