Products for Research Use Only
RegisterLogin

LSM1, Human (His)

CAT: 0804-HY-P70198Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70198Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation.Likely part of an LSm subunit-containing complex involved in general mRNA degradation.It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase.The LSm subunits collectively form a donut-shaped heteromer.LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E.coli , with C-6*His labeled tag.
Product Name Alternative
LSM1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lsm1-protein-human-his.html
Smiles
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Molecular Formula
27257 (Gene_ID) O15116 (M1-Y133) (Accession)
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS07852LSM1 Human Pre-designed siRNA Set A
HY-P88329-01LSM1 Antibody (YA8013, Mouse)
HY-P70944LSM4, Human (His)
HY-P75915-01LSM3, Human (His)
HY-RS20769Lsm1 Mouse Pre-designed siRNA Set A
HY-RS27283Lsm1 Rat Pre-designed siRNA Set A
HY-P76688UBE2F, Human (His)
HY-P71535-01TEAD4, Human (His)
HY-P76754-01CABP5, Human (His)
HY-P76504-01NAPG, Human (His)

Alternative Products

CatalogName
E40KMPH4486Human LSM1 Protein, His Tag
P516744LSM1 Protein (C-His, Human)
TMPY-03390-01LSM1 Protein, Human, Recombinant (His)
P526506LSM1 Protein (N-His, Human)
E40KMH1359Recombinant Human LSM1 Protein, His Tag
E45H52342E1-100LSM1 Protein, Human, Recombinant (His Tag)
PR00430Recombinant Human LSM1 Protein, C-His
PKSH033172-01Recombinant Human LSM1 Protein (His Tag)
AR09672PU-NLSM1 (1-133, His-tag) Human Protein
PV024466LSM1 Protein Vector (Human) (pPB-N-His)

Popular Products