Products for Research Use Only
RegisterLogin

CNTF, Human

CAT: 0804-HY-P7146-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7146-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Human is produced by E. coli (A2-M200) with tag free.
Product Name Alternative
CNTF Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cntf-protein-human.html
Purity
98.0
Smiles
AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Molecular Formula
1270 (Gene_ID) P26441 (A2-M200) (Accession)
Molecular Weight
Approximately 24-27 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[2]Pasquin S, et al. Ciliary neurotrophic factor (CNTF) : New facets of an old molecule for treating neurodegenerative and metabolic syndrome pathologies. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :507-15.|[3]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[4]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[5]Zurn A D, et al. Combined effects of GDNF, BDNF, and CNTF on motoneuron differentiation in vitro[J]. Journal of neuroscience research, 1996, 44 (2) : 133-141.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7148-01CNTF, Rat
HY-P7147-01CNTF, Mouse
HY-P7148A-01CNTF, Rat (His)
HY-P74242-01CNTF, Mouse (His)
HY-P74242AF-01Animal-Free CNTF, Mouse (His)
HY-RS16555Cntf Mouse Pre-designed siRNA Set A
HY-RS22988Cntf Rat Pre-designed siRNA Set A
HY-P76275CNTFR alpha, Human (sf9, His)
HY-P703356CNT3, Human (sf9, Strep, His)
HY-RS02924CNTFR Human Pre-designed siRNA Set A

Alternative Products

CatalogName
YP-W10818-01Human CNTF (CNTF) ELISA Kit
MBS8575294-01CNTF, Human
OM297598-01CNTF Human
300-107P-5ugHuman CNTF
P1151-.5Recombinant Human CNTF
OM297596-01CNTF Human, His
GTR18884257-01Human CNTF protein
32192-05111Human CNTF Antibody
P1093-50CNTF, human recombinant
MBS516761-01CNTF

Popular Products