CNTF, Mouse

• Description:

  CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Mouse is produced by E. coli (A2-M198) with tag free.

• Product Name Alternative:

  CNTF Protein, Mouse, Mouse, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/cntf-protein-mouse.html

• Purity:

  95.00

• Smiles:

  AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM

• Molecular Formula:

  12803 (Gene_ID) P51642 (A2-M198) (Accession)

• Molecular Weight:

  Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293 (39) :15256-15268.|[2]Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17 (7) :912-21.|[3]Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18 (12) :773-789.|[4]Holm NR, et al. CNTF inhibits high voltage activated Ca2+ currents in fetal mouse cortical neurones. J Neurochem. 2002 Aug;82 (3) :495-503.|[5]Watt MJ, et al. CNTF reverses obesity-induced insulin resistance by activating skeletal muscle AMPK. Nat Med. 2006 May;12 (5) :541-8.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins