MIF Human, Active

• Description:

  MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

• Swiss Prot:

  P14174

• Source:

  Escherichia Coli.

• Buffer:

  MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

• Storage Conditions:

  Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM