MIF Human His C

• Description:

  MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

• Swiss Prot:

  P14174

• Source:

  Escherichia Coli.

• Buffer:

  Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.

• Storage Conditions:

  Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC