Products for Research Use Only

MIF Human His C

CAT: 1071-OM301203-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM301203-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Swiss Prot
P14174
Source
Escherichia Coli.
Buffer
Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.
Storage Conditions
Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC