MIF Human His C

CAT: 1071-OM301203-01Size: 5 µgDry Ice: NoHazardous: No

CAT#:1071-OM301203-01Size:5 µg

Selected

PRICE

AVAILABILITY: InStock

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

1 / 1

Description

MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.

Swiss Prot

P14174

Source

Escherichia Coli.

Buffer

Human MIF was lyophilized from a 1 mg/mL solution containing PBS pH-7.4.

Storage Conditions

Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC

Related Products

Catalog	Name
OM301229-01	MIF Human His N
OM301193-01	MIF Mouse, His
OM301205-01	MIF Human
OM301235-01	MIF Human, Active
OM301199-01	MIF Human, GST
OM301191-01	MIF Rat
OM301195-01	MIF Mouse
OM301197-01	MIF T.Vaginalis
OM303842-01	Troponin-C His Human
OM301075-01	EPGN Human, His

Alternative Products

Catalog	Name
9230-50	Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200	Human CellExp™ Human Serum Albumin, Human Recombinant
4062850/10	HUMAN PHYSIOLOGY Human Heart
4062850/6	HUMAN PHYSIOLOGY Human Eye
PT_72990-01	Myeloperoxidase Human (MPO Human)
PT_42051-01	Secretin Human (Secretin Human)
PT_41407-01	LeukinFeron Human (LeukinFeron Human)
PT_74124-01	Fibronectin Human (Fibronectin Human)
PT_42353-01	Uromodulin Human (UMOD Human)
PT_42253-01	Thyroglobulin Human (Thyroglobulin Human)

MIF Human His C

Related Products

Alternative Products

Popular Products