Products for Research Use Only
RegisterLogin

Activin-A Human Plant-Active

CAT: 1071-OM300725-01Size: 1 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM300725-01Size:1 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Active form Activin-A Human Recombinant produced in Plant is a homodimeric, glycosylated, polypeptide chain containing 2 x 116 amino acids and having a molecular weight of 27.4kDa.
Swiss Prot
P08476
Source
Nicotiana benthamiana.
Buffer
Active form Activin-A was lyophilized from a concentrated 1 mg/mL protein solution containing 50mM Tris-HCl pH-7.4
Storage Conditions
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Repeated freezing and thawing is not recommended.
Sequence Similarities
HHHHHHGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSG

Related Products

CatalogName
OM300737-01Activin-A Human Active
OM300749-01Activin A Human Plant
OM300733-01Activin-A Human, HEK-Active
OM300731-01Activin B Human Active
OM300735-01Activin A Human
OM643740-01Recombinant Human Activin A
OM643114Recombinant Human Activin A
OM300755-01Activin B Human
OM305945-01SERPINA1 Human, Active
OM304168-01CST3 Human, Active

Alternative Products

CatalogName
rAP-2130Activin-A Human Recombinant, Plant-Active
GTR18985458-01Human Activin-A Plant-Active Protein
PROTP08476-3Activin-A Human Recombinant Protein, Plant-Active
7-00008Recombinant Human Activin-A, Plant
rAP-2123Activin A Human Recombinant, Plant
7-00004Recombinant Human Activin-A Active
GTR18985459-01Human Activin-A Active Protein
rAP-2127Activin-A Human Recombinant, Active
MBS145200-01Recombinant Human Activin-A, Active
7-00014Recombinant Human Activin-B, Plant

Popular Products