PDGF-BB, Human

CAT: 0804-HY-P7055-01Size: 5 µgDry Ice: NoHazardous: No
CAT#:0804-HY-P7055-01Size:5 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.
Product Name Alternative
PDGF-BB Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-bb-protein-human.html
Purity
98.0
Smiles
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Molecular Formula
5155 (Gene_ID) P01127-1 (S82-T190) (Accession)
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23 (1) :32-39.|[2]Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32 (1) :145-50.|[3]Chen L, et al. Inhibition of PDGF-BB reduces alkali-induced corneal neovascularization in mice. Mol Med Rep. 2021 Apr;23 (4) :238.|[4]Park SA, et al. PDGF-BB does not accelerate healing in diabetic mice with splinted skin wounds. PLoS One. 2014 Aug 14;9 (8) :e104447.|[5]Chung R, et al. Potential roles of growth factor PDGF-BB in the bony repair of injured growth plate. Bone. 2009 May;44 (5) :878-85.|[6]Au P, et al. Paradoxical effects of PDGF-BB overexpression in endothelial cells on engineered blood vessels in vivo. Am J Pathol. 2009 Jul;175 (1) :294-302.|[7]Cao H, et al. PDGF-BB prevents destructive repair and promotes reparative osteogenesis of steroid-associated osteonecrosis of the femoral head in rabbits. Bone. 2023 Feb;167:116645.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7278-01PDGF-BB, Rat
HY-P7087-01PDGF-BB, Mouse
HY-P70699-01PDGF-BB, Mouse (His)
HY-P7278A-01PDGF-BB, Rat (His)
HY-P70699A-01PDGF-BB, Mouse (C-His)
HY-P701237PDGF-BB, Bovine (P. pastoris)
HY-P74642PDGF-BB, Canine (P.pastoris, His)
HY-P75966-01PDGF-BB, Cynomolgus (HEK293, mFc, solution)
HY-P73352-01PDGF-BB, Mouse (P.pastoris, His)
HY-P75966A-01PDGF-BB Protein, Cynomolgus (HEK293, mFc)

Alternative Products

CatalogName
167941PDGF-BB, Recombinant, Human, (Human PDGF-BB, h-PDGF-BB, PDGFBB, PDGF BB, PDGF-BB, rh-PDGF-BB, recombinant human PDGF-BB, recombinant PDGF-BB, PDGF) discontinued
Z03707-1PDGF-BB, Human
MBS692079-01Human PDGF-BB
HC88829Human PDGF BB
OM301305-01PDGF BB Human
FY-PN53197Recombinant Human Pdgf-Bb
CB-1109201PDGF-BB human rec.
OM301299-01PDGF BB Human, Yeast
300-985P-050GMP Human PDGF-BB
MBS189628-01Human PDGF-BB Protein

Popular Products