PDGF-BB, Human

• Description :

  PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.

• Product Name Alternative :

  PDGF-BB Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/pdgf-bb-protein-human.html

• Purity :

  98.0

• Smiles :

  SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

• Molecular Formula :

  5155 (Gene_ID) P01127-1 (S82-T190) (Accession)

• Molecular Weight :

  Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23 (1) :32-39.|[2]Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32 (1) :145-50.|[3]Chen L, et al. Inhibition of PDGF-BB reduces alkali-induced corneal neovascularization in mice. Mol Med Rep. 2021 Apr;23 (4) :238.|[4]Park SA, et al. PDGF-BB does not accelerate healing in diabetic mice with splinted skin wounds. PLoS One. 2014 Aug 14;9 (8) :e104447.|[5]Chung R, et al. Potential roles of growth factor PDGF-BB in the bony repair of injured growth plate. Bone. 2009 May;44 (5) :878-85.|[6]Au P, et al. Paradoxical effects of PDGF-BB overexpression in endothelial cells on engineered blood vessels in vivo. Am J Pathol. 2009 Jul;175 (1) :294-302.|[7]Cao H, et al. PDGF-BB prevents destructive repair and promotes reparative osteogenesis of steroid-associated osteonecrosis of the femoral head in rabbits. Bone. 2023 Feb;167:116645.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins