PDGF-BB, Rat

• Description:

  PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

• Product Name Alternative:

  PDGF-BB Protein, Rat, Rat, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat.html

• Purity:

  97.00

• Smiles:

  SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

• Molecular Formula:

  24628 (Gene_ID) Q05028 (S74-T182) (Accession)

• Molecular Weight:

  Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• References & Citations:

  [1]Badwelan M, et al. The Efficacy of Recombinant Platelet-Derived Growth Factor on Beta-Tricalcium Phosphate to Regenerate Femoral Critical Sized Segmental Defects: Longitudinal In Vivo Micro-CT Study in a Rat Model. J Invest Surg. 2018 Nov 15:1-13.|[2]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins