PDGF-BB, Mouse

• Description :

  PDGF-BB Protein, Mouse is an active PDGF isoform, used in cell culture applications.

• Product Name Alternative :

  PDGF-BB Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/pdgf-bb-protein-mouse.html

• Purity :

  96.00

• Smiles :

  SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT

• Molecular Formula :

  18591 (Gene_ID) P31240 (S82-T190) (Accession)

• Molecular Weight :

  Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23 (1) :32-39.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins