FGF-9, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FGF-9, Human
Description :
FGF-9 Protein, Human is a steroid-regulated mitogen and survival factor for nerve and mesenchymal cells.Product Name Alternative :
FGF-9 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsApplications :
Neuroscience-NeuromodulationAssay Protocol :
https://www.medchemexpress.com/cytokines/fgf-9-protein-human.htmlPurity :
98.0Smiles :
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQSMolecular Formula :
2254 (Gene_ID) P31371 (M1-S208) (Accession)Molecular Weight :
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.References & Citations :
[1]Wing LY, et al. Expression and mitogenic effect of fibroblast growth factor-9 in human endometriotic implant is regulated by aberrant production of estrogen. J Clin Endocrinol Metab. 2003 Nov;88 (11) :5547-54.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

