FGF-9, Mouse (His, solution)

• Description :

  FGF-9 Protein, Mouse (His, solution) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

• Product Name Alternative :

  FGF-9 Protein, Mouse (His, solution), Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-9-protein-mouse.html

• Purity :

  98.0

• Smiles :

  MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

• Molecular Formula :

  14180 (Gene_ID) P54130 (M1-S208) (Accession)

• Molecular Weight :

  Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Yusuf IO, et al. Fibroblast Growth Factor 9 Suppresses Striatal Cell Death Dominantly Through ERK Signaling in Huntington's Disease. Cell Physiol Biochem. 2018;48 (2) :605-617.

• Shipping Conditions :

  Dry ice.

• Storage Conditions :

  Stored at -80°C for 1 year

• Scientific Category :

  Recombinant Proteins