BMP-4

CAT:
209-M10-044-L250
Size:
250 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BMP-4 - image 1

BMP-4

  • Description :

    Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. This E.coli derived murine BMP-4 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.
  • Synonyms :

    Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1
  • NCBI Gene ID :

    12159
  • UniProt :

    P21275
  • Accession Number :

    NP_031580
  • Accession Number mRNA :

    NM_007554
  • Chromosomal Location :

    14 C1; 14 15.0 cM
  • Reactivity :

    Mouse
  • Cross Reactivity :

    Mouse
  • Sequence :

    KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
  • Assay Protocol :

    Centrifuge vial prior to opening. Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
  • Endotoxin :

    < 0.1 ng/µg of protein (< 1EU/µg)
  • Purity :

    >98% by SDS-PAGE & HPLC analysis
  • Bioactivity :

    Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
  • Length :

    106
  • Form :

    Lyophilized
  • Buffer :

    10mM Citric Acid
  • Reconstitution :

    10mM Citric Acid
  • Molecular Weight :

    23.9 kDa
  • Storage Conditions :

    The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.
  • Host or Source :

    E. coli

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide