MRPL30 Rabbit pAb (APR23124N)

CAT: 0882-APR23124N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR23124N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPL30 Rabbit pAb (APR23114N9) .

Synonyms

MRPL30; L28MT; L30MT; MRP-L28; MRP-L30; MRPL28; MRPL28M; RPML28

Gene ID

51263

UniProt

Q8TCC3

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa/18kDa/21kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51263

Uniprot URL

https://www.uniprot.org/uniprot/Q8TCC3

AA Sequence

MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES

UniProtKB · Q8TCC3

Large ribosomal subunit protein uL30m

RM30_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: Q8TCC3
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: MRPL30
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: A6NIC6, D3DVI0, D3DVI3, Q0D2Q7, Q6ZTP4, Q96Q69, Q9P0N0

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Cellular component

Mitochondrion

Molecular function

RibonucleoproteinRibosomal protein

Domain

Transit peptide

Related Products

Catalog	Name
APR22824N-01	MRPL18 Rabbit pAb (APR22824N)
APR23824N-01	CD1D Rabbit pAb (APR23824N)
APR23174N-01	KLHL15 Rabbit pAb (APR23174N)
APR23142N-01	CHDH Rabbit pAb (APR23142N)
APR23126N-01	POP5 Rabbit pAb (APR23126N)
APR23125N-01	CD46 Rabbit pAb (APR23125N)
APR23123N-01	CKLF Rabbit pAb (APR23123N)
APR23104N-01	DCAF12 Rabbit pAb (APR23104N)
APR22124N-01	FLYWCH2 Rabbit pAb (APR22124N)
APR21124N-01	CCKBR Rabbit pAb (APR21124N)

Alternative Products

Catalog	Name
MBS8550381-01	MRPL30 Rabbit pAb
GTR18232082-01	MRPL30 Rabbit Polyclonal Antibody
SL17777R-01	Rabbit Anti-MRPL30 antibody
GTR18343944	MRPL30 Rabbit Polyclonal Antibody (Biotin)
GTR18343943	MRPL30 Rabbit Polyclonal Antibody (FITC)
GTR18343942	MRPL30 Rabbit Polyclonal Antibody (HRP)
MBS8109617-01	Anti-MRPL30 Antibody, Rabbit Polyclonal
PA10229-01	Rabbit Anti-Human MRPL30 pAb
PAV3404	Rabbit Anti-RM30/MRPL30 Polyclonal Antibody
GTR10433465	Rabbit 39S ribosomal protein L30, mitochondrial (MRPL30) ELISA kit