CD1D Rabbit pAb (APR23824N)

CAT: 0882-APR23824N-01Size: 50 µLDry Ice: NoHazardous: No

1 / 1

CAT#:0882-APR23824N-01Size:50 µL

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Background

This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD1D Rabbit pAb (APR23824N) .

Synonyms

CD1D; CD1A; R3; R3G1

Gene ID

912

UniProt

P15813

Cellular Locus

Cell membrane, Endosome membrane, Lysosome membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=912

Uniprot URL

https://www.uniprot.org/uniprot/P15813

AA Sequence

EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSG

UniProtKB · P15813

Antigen-presenting glycoprotein CD1d

CD1D_HUMAN · Homo sapiens

View on UniProt ↗

Primary accession: P15813
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: CD1D
Protein existence: 1: Evidence at protein level
Organism: Homo sapiens (Human)
Taxonomy ID: 9606
Alternative names: —
EC number: —
Processing: Precursor
Secondary accessions: D3DVD5, Q5W0J3, Q9UMM3, Q9Y5M4

Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Cellular component

Cell membraneEndoplasmic reticulumEndosomeLysosomeMembrane

PTM

Disulfide bondGlycoprotein

Biological process

ImmunityInnate immunity

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Related Products

Catalog	Name
APR23894N-01	STEAP1 Rabbit pAb (APR23894N)
APR23854N-01	CLCA4 Rabbit pAb (APR23854N)
APR23828N-01	SCAMP2 Rabbit pAb (APR23828N)
APR23822N-01	RNF144A Rabbit pAb (APR23822N)
APR23821N-01	HS6ST1 Rabbit pAb (APR23821N)
APR23814N-01	MGAM Rabbit pAb (APR23814N)
APR23524N-01	PMF1 Rabbit pAb (APR23524N)
APR22824N-01	MRPL18 Rabbit pAb (APR22824N)
APR21824N-01	CRYBA4 Rabbit pAb (APR21824N)
APR23924N-01	ARHGEF10L Rabbit pAb (APR23924N)

Alternative Products

Catalog	Name
A1760-01	CD1D Rabbit pAb
GTR18216606-01	Rabbit CD1D Antibody
A24163-01	CD1d Rabbit mAb
MBS7256544-01	Rabbit Antigen Presenting Glycoprotein CD1d (CD1D) ELISA Kit
MBS9901305	Rabbit Antigen-Presenting Glycoprotein CD1D (CD1D) ELISA Kit
MBS9512516-01	CD1D Rabbit Polyclonal Antibody
NBP2-57561-25ul	Rabbit Polyclonal CD1d Antibody
GTR18051199	CD1D rabbit pAb Antibody
144311	CD1D (R3G1, CD1d)
033471	CD1D, ID (CD1D, Antigen-presenting glycoprotein CD1d, R3G1, CD1d)