Activator protein 2 (AP-2/TFAP2A) Rabbit pAb (APR17440N)

CAT:
882-APR17440N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Activator protein 2 (AP-2/TFAP2A) Rabbit pAb (APR17440N) - image 1

Activator protein 2 (AP-2/TFAP2A) Rabbit pAb (APR17440N)

  • Background:

    The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS) . Three transcript variants encoding different isoforms have been found for this gene.
  • Synonyms:

    TFAP2A; AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
  • Gene ID:

    7020
  • UniProt:

    P05549
  • Cellular Locus:

    Nucleus
  • Applications:

    IHC (Homo sapiens) WB (Homo sapiens)
  • Dilution:

    WB 1:200 - 1:1000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 40kDa/47kDa/48kDa Observed MW: 50KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Activator protein 2 (AP-2/TFAP2A) Rabbit pAb (APR17440N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7020
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P05549
  • AA Sequence:

    MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK