Products for Research Use Only
RegisterLogin

IdeS, Streptococcus pyogenes (His)

CAT: 0804-HY-P74867A-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P74867A-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (His) is the recombinant IdeS protein, expressed by E. coli , with N-10*His labeled tag.
Product Name Alternative
IdeS Protein, Streptococcus pyogenes (His), Others, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ides-protein-streptococcus-pyogenes-n-his.html
Purity
95.00
Smiles
DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN
Molecular Formula
/ (Gene_ID) F8V4V0 (D30-N341) (Accession)
Molecular Weight
Approximately 34 kDa
References & Citations
[1]von Pawel-Rammingen U. Streptococcal IdeS and its impact on immune response and inflammation. J Innate Immun. 2012;4 (2) :132-40.|[2]Shin JI, et al. Anti-glomerular basement membrane disease (Goodpasture disease) : From pathogenesis to plasma exchange to IdeS. Ther Apher Dial. 2022 Feb;26 (1) :24-31.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P703489-01IdeS, Streptococcus pyogenes
HY-P704245SPEB, Streptococcus pyogenes (His-SUMO)
HY-P72060A-01ACPS, Streptococcus pyogenes serotype M28 (His)
HY-E70069Endo S2, Streptococcus pyogenes
HY-P72060ACPS, Streptococcus pyogenes serotype M28 (sf9, His-Myc)
HY-P72047APT, Streptococcus pyogenes serotype M1 (sf9, His-Myc)
HY-P703496Cas9, Streptococcus pyogenes serotype M1
HY-E70069GLEndo S2, Streptococcus pyogenes (GMP Like)
HY-E70365-01IdeS protease
HY-E70365AIdeS (Immobilized, Microspin)

Alternative Products

CatalogName
GTR18877786-01Streptococcus pyogenes IdeS Protein
TMPY-06023-01IdeS Protein, Streptococcus pyogenes, Recombinant (His)
GTR18912242Streptococcus pyogenes IdeS Recombinant Protein
TMPY-06179IdeS Protein, Streptococcus pyogenes, Recombinant (His & GST)
E45O55305E1-100IdeS Protein, Streptococcus pyogenes, Recombinant (His Tag)
PO55274E6IdeS Protein, Streptococcus pyogenes, Recombinant (His & GST Tag)
RPC28736-01Recombinant Streptococcus pyogenes Immunoglubulin-degrading enzyme (ideS)
MBS8430665-01Bacteria-Derived Streptococcus pyogenes IdeS Recombinant Protein His Tag 2500U
P508786Streptococcus pyogenes sortase Protein (N-His, Streptococcus pyogenes)
P508784Streptococcus pyogenes M1 Protein (C-His, Streptococcus pyogenes)

Popular Products