Products for Research Use Only
RegisterLogin

FGF 23 Human, His

CAT: 1071-OM300913-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM300913-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Fibroblast Growth Factor-23 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His tag) and having a molecular mass of 28629.5 Dalton.
Swiss Prot
Q9GZV9
Source
Escherichia Coli.
Buffer
The protein (0.5 mg/mL) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution.
Storage Conditions
Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARN

Related Products

CatalogName
OM300841-01FGF 23 C-term Human
OM300907-01FGF 21 Human, His
OM300889-01FGF 18 Human, His
OM300883-01FGF 19 Human, His
OM296618-01IL 23 Human, His
OM300851-01FGF 21 Mouse, His
OM300893-01FGF 1 Mouse, His
OM300895-01FGF 19 Human
OM300837-01FGF 8 Human
OM300899-01FGF 1 Human

Alternative Products

CatalogName
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)
PT_41403-01Human Leptin (Leptin Human)
PT_40803-01Haptoglobin Human (Haptoglobin Human)

Popular Products