UBE2D3, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


UBE2D3, Human
Description :
UBE2D3 is able to accept ubiquitin from specific E2 ubiquitin-conjugating enzymes and transfer it to substrates, often promoting its degradation by the proteasome[1]. UBE2D3 Protein, Human is the recombinant human-derived UBE2D3 protein, expressed by E. coli , with tag free.Product Name Alternative :
UBE2D3 Protein, Human, Human, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/ube2d3-protein-human.htmlPurity :
98.0Smiles :
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPELARIYKTDRDKYNRISREWTQKYAMMolecular Formula :
7323 (Gene_ID) AAH66917 (M1-M147) (Accession)Molecular Weight :
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Dry ice.Storage Conditions :
Stored at -80°C for 1 yearScientific Category :
Recombinant Proteins

