IHH, Human

• Description :

  IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.

• Product Name Alternative :

  IHH Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Applications :

  Neuroscience-Neuromodulation

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ihh-protein-human.html

• Purity :

  98.0

• Smiles :

  GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG

• Molecular Formula :

  3549 (Gene_ID) Q14623 (G29-G202) (Accession)

• Molecular Weight :

  Approximately 20 kDa

• References & Citations :

  [1]Van den Brink GR, et al. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation. Nat Genet. 2004 Mar;36 (3) :277-82. Epub 2004 Feb 8.|[2]St-Jacques B, et al. Indian hedgehog signaling regulates proliferation and differentiation of chondrocytes and is essential for bone formation. Genes Dev. 1999 Aug 15;13 (16) :2072-86.|[3]Vortkamp A, et al. Regulation of rate of cartilage differentiation by Indian hedgehog and PTH-related protein. Science. 1996 Aug 2;273 (5275) :613-22.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins