IHH, Human

CAT:
804-HY-P7204-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IHH, Human - image 1

IHH, Human

  • Description :

    IHH Protein, Human is involved in chondrocyte differentiation, proliferation and maturation especially during endochondral ossification.
  • Product Name Alternative :

    IHH Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Applications :

    Neuroscience-Neuromodulation
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/ihh-protein-human.html
  • Purity :

    98.0
  • Smiles :

    GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
  • Molecular Formula :

    3549 (Gene_ID) Q14623 (G29-G202) (Accession)
  • Molecular Weight :

    Approximately 20 kDa
  • References & Citations :

    [1]Van den Brink GR, et al. Indian Hedgehog is an antagonist of Wnt signaling in colonic epithelial cell differentiation. Nat Genet. 2004 Mar;36 (3) :277-82. Epub 2004 Feb 8.|[2]St-Jacques B, et al. Indian hedgehog signaling regulates proliferation and differentiation of chondrocytes and is essential for bone formation. Genes Dev. 1999 Aug 15;13 (16) :2072-86.|[3]Vortkamp A, et al. Regulation of rate of cartilage differentiation by Indian hedgehog and PTH-related protein. Science. 1996 Aug 2;273 (5275) :613-22.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide