NEDD8, Human

• Description :

  NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  NEDD8 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/nedd8-protein-human.html

• Purity :

  98.0

• Smiles :

  MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

• Molecular Formula :

  4738 (Gene_ID) Q15843 (M1-G76) (Accession)

• Molecular Weight :

  Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins