Cy5-ProTx-I

• Description:

  Cy5-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

• Specifications:

  Blocker of voltage-gated sodium channels and T-type Cav

• Target:

  Na channels

• Sequence:

  YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

• Peptide Number:

  PTF001

• Disulfide Bonds:

  Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

• N Terminal Sequence:

  Cy5

• C Terminal Sequence:

  OH